SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|104784265|ref|YP_610763.1| from Pseudomonas entomophila L48

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|104784265|ref|YP_610763.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.5e-31
Family Frataxin-like 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|104784265|ref|YP_610763.1|
Sequence length 110
Comment frataxin-like protein [Pseudomonas entomophila L48]
Sequence
MSLSEARFHDLVDATQQALEDLFDESDLDLDMENSAGVLTVKFDNGSQLIFSRQEPLRQL
WLADRSGGFHFDYDEESGKWVCEKTEELLGEMLERIVWERAGEKLDFDEI
Download sequence
Identical sequences Q1I306
384676.PSEEN5363 WP_011536338.1.45913 gi|104784265|ref|YP_610763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]