SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|104780517|ref|YP_607015.1| from Pseudomonas entomophila L48

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|104780517|ref|YP_607015.1|
Domain Number 1 Region: 421-560
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.83e-33
Family Flavohemoglobin, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 320-418
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.92e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 547-661
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.14e-19
Family 2Fe-2S ferredoxin-related 0.014
Further Details:      
 
Domain Number 4 Region: 164-267
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0000000365
Family PNP-oxidase like 0.01
Further Details:      
 
Weak hits

Sequence:  gi|104780517|ref|YP_607015.1|
Domain Number - Region: 31-128
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0926
Family PNP-oxidase like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|104780517|ref|YP_607015.1|
Sequence length 671
Comment FAD-binding oxidoreductase [Pseudomonas entomophila L48]
Sequence
MRSPWHAGEKQLQEHVGVAERMEVFGQKVIRDYMPDQHRAFYHQLPFMVAGAVDAQGKPW
ATLLEGPEGFVSSPDPRQLMIGTNLAGDDPATPGLVTGGAIGLLGIELHTRRRNRLNGLI
RRASGDQLEVQVEQSFGNCPQYIQLRDYTRVDEPPQGRWDSATLDTTTRAMIENADTFFV
ASYVDQDGAQRSVDVSHRGGRPGFVRVEGNRLSIPDYAGNLHFNTLGNLLVNPVAGLLFV
DFSTGDVLQVCGRTEVILDSPLISAFVGAERIWTLDIEQVVFRPAAVSLRWAFQAYAPTS
LMTGTWAEAEQRLQQRARQHQWLAWRVLRIEQESRDIRSYYLQSEEGVPVAFAPGQHIPV
RLRINGQTPLIRTYSLSSAPSDGFLRISVKAQGPASRYLHQQVKVGDHLEVRQPMGSFTL
DLQSDRPLVLIGAGVGITPLIAMLREQLAKGQGRRIHLFQGGRTLADLPFQQELAALQQQ
ANGLLSIHRALSQPEPQAVPGRDYAFASRLGIGQIKATLALDDYDFYLCGPASFTQDLYE
GLRGVHVPDARIHAEAFGPSTLRRHTDDNQPTLRQPPPATEPVPVHFASSAKEARWAPGS
GTLLELAESRGLAPDFSCRGGSCGTCRTKLLSGQVHYPNPPVELPDEGFALICCAVPAQA
QEGANVLVLEL
Download sequence
Identical sequences Q1IDQ4
384676.PSEEN1322 WP_011532621.1.45913 gi|104780517|ref|YP_607015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]