SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379733585|ref|YP_005327090.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379733585|ref|YP_005327090.1|
Domain Number 1 Region: 8-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-81
Family Protein kinases, catalytic subunit 0.0000000177
Further Details:      
 
Weak hits

Sequence:  gi|379733585|ref|YP_005327090.1|
Domain Number - Region: 566-631
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0327
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379733585|ref|YP_005327090.1|
Sequence length 641
Comment Two component serine/threonine-protein kinase with PASTA sensors [Blastococcus saxobsidens DD2]
Sequence
MTTPQVLGERYEIGGVLGRGGMAEVHLGRDLRLGREVAVKVLRNDLARDPSFQVRFRREA
QASASLNHPAIVAVYDTGEDRTPSGATPYIVMEYVEGETLRDVLRREGRLPIERAMSLAA
DICGALDFSHRNGIVHRDVKPGNVMITPQGTVKVMDFGIARAVSDSAATMTSTAAVIGTA
QYLSPEQARGEGVDARSDVYSLGCLLYELVTGAPPFTGDSPVSVAYQHVREDPRLPSSIN
RDVPPELDAILMKAMSKNPANRYQSAADMRNDLLRALAGQRVEATPVMGEDEKTAIIGAP
VGSYRYADDDWDGDEEARRRKRRIIAIVSVLAVLLLGGAIAAAVALNGGAEPPPVVAQQV
QVPPVVDQPVAEARQAITDAGLAVGEVAERDTTDPDQVGVVLETTPAGGAQVDPGSEVAL
VVGVAPDSITVPSLVGFTEDQAREALERAGFTGSIDTREEDSLEEEGTVASVEPAVGAPV
PPDGTVTLGLSTGTVDLPDVTGVPQAQAIATLTEAGFTEAQILVEEIESAEAPGTVVSTT
PGPAGPASTGTRIVLQVSGGVAEVEDIAVPDVRGQSAAAAEANLRAAGFSSIRFEDVGGE
GDPDVGPSEVIDTEPPAGTPLPPDAEIIVLLNPPEGEAETE
Download sequence
Identical sequences H6RJC8
WP_014373958.1.69969 gi|379733585|ref|YP_005327090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]