SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379734005|ref|YP_005327510.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379734005|ref|YP_005327510.1|
Domain Number 1 Region: 33-341
Classification Level Classification E-value
Superfamily Aldolase 2.2e-98
Family HMGL-like 0.000000000663
Further Details:      
 
Domain Number 2 Region: 475-575
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 2.22e-35
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 409-458
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.0000000000000392
Family DmpG/LeuA communication domain-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379734005|ref|YP_005327510.1|
Sequence length 577
Comment 2-isopropylmalate synthase [Blastococcus saxobsidens DD2]
Sequence
MSDTHPHARHPQQPSRMPVHRYAPFTPVVLPDRTWPDTVTAKAPRWCAVDLRDGNQALID
PMTPDRKRRMFELLVRMGYKEIEVGFPAASQTDYDFVRQLIEEDLVPDDVTIQVLTQARD
ELIERTFESLHGAEQAIVHLYNSTSTLQRRVVFNSDRAGIVDIAVHGAQVVRKLAEQLGD
TDIRFEYSPESFTGTELDFAVEICNAVTDVWEPTPQRPTILNLPATVEMAEPTVYADQVE
WMHRNLARRDAVVLSLHPHNDRGTAVAAAELGYRAGADRIEGCLFGNGERTGNVDLVTLG
LNLFSQGIDPEIDFSDIDDIRRTVEYCNQLGVHERHPYGGDLVYTAFSGSHQDAINKGFT
ALEADARAAGVPVEQQTWAVPYLPIDPKDVGRSYEAVIRVNSQSGKGGVAYIMKTENHLD
LPRRLQIEFSAVIQRHTDDEGGEVTAQQMWTAFTNEYLPDPEAPWGRFSLSGHRHTAHGD
SLDEMVVELVDQGVPVTVEGRGNGPIAAFVDALSTLDVDVRVLDYAEHAMSAGGDARAAA
YVECAVGERVLWGVGIDPNIVSASLRAVVSAVNRAQR
Download sequence
Identical sequences H6RP00
gi|379734005|ref|YP_005327510.1| WP_014374378.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]