SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379734260|ref|YP_005327765.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379734260|ref|YP_005327765.1|
Domain Number 1 Region: 597-818
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-30
Family Laminin G-like module 0.033
Further Details:      
 
Domain Number 2 Region: 826-910
Classification Level Classification E-value
Superfamily PKD domain 2.75e-22
Family PKD domain 0.0016
Further Details:      
 
Domain Number 3 Region: 911-993
Classification Level Classification E-value
Superfamily PKD domain 7.85e-22
Family PKD domain 0.0016
Further Details:      
 
Domain Number 4 Region: 62-302
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000419
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379734260|ref|YP_005327765.1|
Sequence length 1220
Comment hypothetical protein BLASA_0770 [Blastococcus saxobsidens DD2]
Sequence
MSARSAAPRALVAGLVALLMTVGAFAGPLGGKAQADSAPLDPADPATPTTVTADALPTVQ
INGVVWSQVVVGDTVYAAGQFTHARPAGAPAGSQETARNNLLAYDIRTGELISSFAPDLN
AQALVVAASPDGSRIYVGGDFSQADGEPRNRIAAYSTSTGQLIPDFRPNVSSRVGAIATA
GSTVYIGGTFTAVGSVSRHRLAALSAADGALLPWNPIPGTGPVLNRDGNTGTSDVVRALV
VTGGGSQVVAGGHFDTLNGVKATGVGALDAVTGETRPFAINQLITNQGTNGAVTGLSTDG
TNVYGTAYDYYGPGNLEGGFSAKADGGAVNWINECHGDTYSSHPLGGALYVAGHPHVCSN
IGGYHEHEPRIHRYATAVSLAPTGTVGTDTLCGSRVTPDGTIVHKSESSYPCSGTLLQGK
PAPSLLTWFPTMAMGSYTGQYQSGWSVAGNEQYVVYGGEFPRVNGTGQQGLVRYALPTSA
PNRVGPAAGALAASVDSPLGGMVRVGWSTTNDRDNEHLIYRVYRDGDNANPVHETARSSL
WWSPQPLDFVDLGVPAGAHTYRVSAVDPLGNRANSPWMPVEVTEGDIVQRSYSDAVRHDG
AAHYWPLGESSGATAYDYAARGDLAVRAGLLGATPDMGEEGAIVDDPDTAFRFRGMTSDS
NLGHLSTQTAVAGPQTFTVEAWFRTTSTAGGKIIGFGSSATGNSGSYDRHVYMDTAGQLN
FGVYPGARLVVTSPSAYNDGQWHHVAASLSPAGMALHVDGVLVGSRTDTTSAAAYTGYWR
VGGDTSWSGAAYFDGLIDEVAVYPTALTPDQVANHHSLGSTGTAINLVPTADFTAATEDL
TAALDATGSIDPDGSITSHEWDFGDGSIGTGATVEHVYAAAGTYTVTLTVTDDHGATAQT
STPVTVTDPPNAEPVAAFTAAVEGLSVSLDGSGSSDADGSIASYGWDFGDGATGAGATAS
HTYAAAGTYTVTLTVTDGEGATGTATESVTVTAGEEPVDPVEPVDPAALVVDTFDRTVTG
GLGTADVGGDWTVQFGAARQSVSPGAATVNLAAAGNNTGSFLGGVSHADVDVRASLVVDQ
APTGGGTFVYIAARRVSETELYRARLRFLTDGTVRLAVTRLSGSFSETVIGGEVLVPGAS
SAAGTALNVRLQLQGAGTTELAATVWAQGAAEPATPTLTRTDSTPSLQAPGGVGLSAYLS
GSATSPVAIRFTALSVQAIG
Download sequence
Identical sequences H6RSH2
WP_014374632.1.69969 gi|379734260|ref|YP_005327765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]