SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379734332|ref|YP_005327837.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|379734332|ref|YP_005327837.1|
Domain Number - Region: 94-131
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0017
Family Phase 1 flagellin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379734332|ref|YP_005327837.1|
Sequence length 134
Comment flagellar basal body rod protein [Blastococcus saxobsidens DD2]
Sequence
MSMFQALSISQSGLMTHRKWLDAAADNIANINTVRRTDEDAFQERLVVAQAVDYGTGEGG
VRVARAEFGDPEGRMVYEPDHPLADAEGYVKYPDIDLGDQMTHMMMAQRGYQANLAVVER
ATNAYQAALQLGKR
Download sequence
Identical sequences H6RTE0
gi|379734332|ref|YP_005327837.1| WP_014374704.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]