SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379734341|ref|YP_005327846.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379734341|ref|YP_005327846.1|
Domain Number 1 Region: 1-293
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.96e-54
Family Phase 1 flagellin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379734341|ref|YP_005327846.1|
Sequence length 293
Comment flagellar hook-associated protein 3 [Blastococcus saxobsidens DD2]
Sequence
MRITQKAVALTSLQGLNRNLDAFGKLQQQLTSGKLINAPSDSPTGTNKAMQTRSEQAAVE
QFGRNISDADSWLSITDSTLQNMLEVTRRVRDLTVQGASTGNSSEASRRALATEVASLRE
SLLGLANTTVQGRPIFGGVTTGTTAYSDAGTFQGIGGADVLRRVSFTEEVRVDLTGPEAF
GPAGADLFAVVARIADDLVTDPASLDQGLVDLDAAMKRMLGGVADVGARAARVEREQQIN
TDLALSLETRLGEVENVDLPNTIMRLQMQQVGYQAALQATAKAISPTLMDYLR
Download sequence
Identical sequences H6RTE9
gi|379734341|ref|YP_005327846.1| WP_014374713.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]