SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379735580|ref|YP_005329086.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379735580|ref|YP_005329086.1|
Domain Number 1 Region: 15-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-73
Family Protein kinases, catalytic subunit 0.00000162
Further Details:      
 
Domain Number 2 Region: 605-660
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000011
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|379735580|ref|YP_005329086.1|
Domain Number - Region: 536-567
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379735580|ref|YP_005329086.1|
Sequence length 663
Comment Two-component serine/threonine-protein kinase PK-1 with PASTA sensors [Blastococcus saxobsidens DD2]
Sequence
MDTAVTDPVVGLVLEGRYRLEERLARGGMSTVYAATDLRLHRTVAVKVMAEHLAHDPTFV
DRFTREARAAAMLSHVNVVSVSDQGSDQGLVFLVMELVRGRTLRDLLSARGRLTVAEALA
VLEPVLAGLTAAHRAGIVHRDIKPENVLIGVDGVVKVADFGLARAVVGTGQTSQTGGVLI
GTVAYLSPEQLERGRADARSDIYAAGIVLYEMLTGHPPFGGDTPLAVAYQHVHHDVPAPS
AEVPGLPWQVDELVARTTRRDPAGRPIDAGAFLAELADVRKDLGIEPVPVPTGQGSARPD
TLRPTNRPTRPRPHDRHPSAPGTEVLAGRASRGGRTSMLPGMGAGPTTDVHGRRPGPARP
RPGVPDHVRRRRTRLAVAIVLLLAITIGAVGWWLGEGRWAAVPSLAGKEETSAIDLLQSA
GLDPDPVVAEWSETVPEGVVIATEPASGEFIRGTDVRVVVSKGAERYTIAPELVGRPIDE
VEAAIQQDVPVQLARGEDYDDDLAPGLVVRFDPPAGTELKRDQVVTAVVSQGRAPVAVPD
VTGQTPDQATSNLQGLGFTVERIEDGRSDQVDVGEVMAVDPAPAAGPVPYGSTVRIQVSA
GVPLVTVPDVVGKTGDEAATILQAAGLQVEATRFFGNNVLRQSPAAGETVERGTPVTILL
SFG
Download sequence
Identical sequences H6RSV2
gi|379735580|ref|YP_005329086.1| WP_014375938.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]