SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379735873|ref|YP_005329379.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379735873|ref|YP_005329379.1|
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 1.83e-16
Family C-terminal domain of arginine repressor 0.0011
Further Details:      
 
Domain Number 2 Region: 5-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2e-16
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379735873|ref|YP_005329379.1|
Sequence length 178
Comment Arginine repressor [Blastococcus saxobsidens DD2]
Sequence
MSSALSRSARQARIRELIEAQPVTSQTQLAALLAESGVEVTQATLSRDLDELGAVKLRGS
DGAPASYVVPPENAPLRPAQTAPARLTRLLADLLTGSEGSANLAVLRTPPGAAQFLASAL
DKVGLPDVLGTIAGDDTLLVVSREPDGGPALAARLRALAQRTPAIYPELKSDLEESSP
Download sequence
Identical sequences H6RWD3
WP_014376231.1.69969 gi|379735873|ref|YP_005329379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]