SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379736075|ref|YP_005329581.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379736075|ref|YP_005329581.1|
Domain Number 1 Region: 120-195
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.36e-19
Family Recombination endonuclease VII, N-terminal domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|379736075|ref|YP_005329581.1|
Domain Number - Region: 2-45
Classification Level Classification E-value
Superfamily SBT domain 0.0275
Family SBT domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379736075|ref|YP_005329581.1|
Sequence length 220
Comment putative endonuclease [Blastococcus saxobsidens DD2]
Sequence
MKTKFCRDCGVHRPVAEFSNNRRSRDGLAFYCREHLAERSARSRDARRLQPRKNRLAPSE
LRIPEGYKWCPDCAEVKPFEQFPRTVASRSGRATYCLPCHNLRGHKSREKVGGARTYHLT
RRYGITVQEADAMLASQDGKCAICRTAPAAHVDHDHATGRVRALLCFNCNGGLGQFKDDP
YVLRAAADYVGFHTLSQYLVTAFEAVGIGPVRAIRPGSHR
Download sequence
Identical sequences H6RJ08
WP_014376433.1.69969 gi|379736075|ref|YP_005329581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]