SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379736488|ref|YP_005329994.1| from Blastococcus saxobsidens DD2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379736488|ref|YP_005329994.1|
Domain Number 1 Region: 27-281
Classification Level Classification E-value
Superfamily Cgl1923-like 1.96e-82
Family Cgl1923-like 0.00000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379736488|ref|YP_005329994.1|
Sequence length 317
Comment putative ATP-grasp superfamily enzyme [Blastococcus saxobsidens DD2]
Sequence
MPQRPEELVELLPAADRFLTRESAVADPSQRRGLVLVHDLAGDFDAASAGTLAGAHLLAA
LQHEVIARFDADSLVDYRARRPRMTFTSDRYESFSAPEISLYAVEDDAGEPFLLLHGAEP
DYAWERFVAAVRGLVERLGVTSVVALQAIPMPVPHTRPVTVTAHATRRQLIEPYPVYWGE
MRIPGSVSALLELRMGEAGVDALGVAAHVPHYLAQATYPAASITLIEHLERLTGLRLPTE
ALREAAEANRTEIDEQIGRSAENTAVVAALEQQYDTFTAAREGTDLLGSAGEVPSAEEIG
AEFERFLADQDRKGPRD
Download sequence
Identical sequences H6RPA4
WP_014376843.1.69969 gi|379736488|ref|YP_005329994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]