SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26987231|ref|NP_742656.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26987231|ref|NP_742656.1|
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.57e-52
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|26987231|ref|NP_742656.1|
Sequence length 218
Comment formate dehydrogenase subunit gamma [Pseudomonas putida KT2440]
Sequence
MNDNKPILRYNANERSNHWAVAILFILAGLSGLALFHPALFWLSNLFGGGPWTRILHPFI
GVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMRNEEEGVPPIGKYNAGQKLLFWTL
LVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAFVLILSIIVHIYAGIWIKGSI
GAMLHGWVSRAWARKHHELWYREVTGDKTPGDHGRKEG
Download sequence
Identical sequences Q88QK0
gi|26987231|ref|NP_742656.1| NP_742656.1.35174 WP_010951783.1.28295 WP_010951783.1.28475 WP_010951783.1.3142 WP_010951783.1.58218 WP_010951783.1.71439 WP_010951783.1.87606 160488.PP_0491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]