SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26988053|ref|NP_743478.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26988053|ref|NP_743478.1|
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.1e-97
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000306
Further Details:      
 
Domain Number 2 Region: 281-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 6.98e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26988053|ref|NP_743478.1|
Sequence length 403
Comment ubiquinol--cytochrome c reductase, cytochrome b [Pseudomonas putida KT2440]
Sequence
MSKFMDWIDARFPATKMWEDHLSKYYAPKNFNFLYFFGSLALLVLVNQIVTGVWLTMSFT
PSAEEAFASVEYIMRDVEYGWILRYLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWL
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGDDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKKKDENGIPLDGIPFHPYY
TVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEQANAFKTPEHIAPVWYFTPFYAIL
RAVPDKLMGVIAMGAAIAVLFVLPWLDRSPVRSMRYKGWISKVFLLVFCVSFVILGVLGV
LAPTPGRTLLSQVCTVLYFAYFLLMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A0A7PWX7 A0A0C5S1P8 A0A179S1I6 Q88N94
160488.PP_1318 gi|26988053|ref|NP_743478.1| NP_743478.1.35174 WP_010952438.1.1467 WP_010952438.1.25194 WP_010952438.1.28295 WP_010952438.1.28475 WP_010952438.1.29846 WP_010952438.1.3142 WP_010952438.1.31851 WP_010952438.1.34900 WP_010952438.1.41 WP_010952438.1.42045 WP_010952438.1.47320 WP_010952438.1.48025 WP_010952438.1.58218 WP_010952438.1.62773 WP_010952438.1.675 WP_010952438.1.71439 WP_010952438.1.87606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]