SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26988435|ref|NP_743860.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26988435|ref|NP_743860.1|
Domain Number 1 Region: 12-617
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.83e-186
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000792
Further Details:      
 
Domain Number 2 Region: 984-1201
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.98e-62
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0000556
Further Details:      
 
Domain Number 3 Region: 587-732
Classification Level Classification E-value
Superfamily ADC-like 8.14e-48
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00014
Further Details:      
 
Domain Number 4 Region: 1203-1357
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.27e-47
Family NADPH-cytochrome p450 reductase-like 0.00017
Further Details:      
 
Domain Number 5 Region: 837-978
Classification Level Classification E-value
Superfamily Flavoproteins 7.38e-42
Family Cytochrome p450 reductase N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26988435|ref|NP_743860.1|
Sequence length 1357
Comment molybdopterin oxidoreductase [Pseudomonas putida KT2440]
Sequence
MPGQPAPFCVFHRSPPMANSEVRSVCPYCGVGCGIVMSVADGKVGKISGDKLHPSNFGRL
CTKGLTAHQPLSASGRMADAYLRQQRSQPPVRTSMDQAIAATAERLRGIIDQHGPDAVAL
YVSGQMSLEAQYLANKLAKGFIRTRHIESNSRLCMASASSGYKLSLGADGPPGSYQDFEH
ADVFLVIGANMADCHPILFLRLLDRVKAGAKLIVVDPRRSATADKADLFLQVRPGSDMAL
LNGLLHLLHRNGHTNPDFIARHTEGWDEMPAFLDDYTPERVAAITGLAEADIIKAAEWIG
SANNWMSCWTMGLNQSIHGTWHSNAICNLHLATGAICRPGSGPFSLTGQPNAMGGRDMGY
MGPGLPGQRSALVEDDRAFVERQWQLPPGSLRSEGGEGTVALFGQMKAGEVKACWVICSN
PVASVANRQQVIDGLRKAELVITQDAFLDTETNRYADILLPAALWAEGEGVMINSERNLT
LMPRAVEPPGQSLPDWQIIARVACAMGYADAFDYPNAEAVYEEIRRFHNPSTGYDLRGIG
YAELRTQPRQWPCAPGSEQHRSPLRYLNDGSSQALLLDARGRRPALAFPTASGKAHFFAR
PWLPAAEVPDDDYPMVLNTGRVQHQWHTLTKTGKVPALNKLEPGPYLEIHPEDAARLGVA
EKDQVAVRSRRGQAVLPARISDRVMPGNCFAPFHWNDLIGEQLAINAATCDAVDPLSLQP
AFKHCAVALERVAGERIDALDLNTATVEPVRMPTATLSRLLGLHTLPVPVLAEEERHYLQ
GFLLGLDQARAEGVPRLPASAPLAASRRLFVDGLLAGLFAQPATAPIAAQAAPWHQVLWA
SQTGNGEQLAERCAARLRGAGLNVQLSCLEAVSPSQLQGAASVVLIASTFGDGDAPDSGA
AFWQALQGEEGAHCAGLPYAVLALGDSSYDQFCGFGRKLDQRLAELGGHRLLARVDCEPD
FDEAFAGWLEALLPALGTAAAPSPASEPAPVSAFSKQQPWMATVLENRLLNGPGASKETR
QLVFDLGGSGFSYAAGDALGVWPRNCPALVEELLTLMQLDGQAMVELKGHSTMPLAEALR
AHLEIAKVTAQQLQAFASNAPDLQRLLQPECKAELQDWLWGRQLVDVLRAFPQQLPLASW
LELLKPLQPRLYSISSSPLAHPGQVHLTVSTVRYGERKGVCSSFLADRAQVQKVAIFPQV
SKHFRLPEDDSVPVIMVGPGTGIAPFRAFLEEREARGAKGDNWLFFGEQYAATDFYYQEQ
LQAWQAAGHLRLDTAFSRDQVEKIYVQQRMLEQGALLWQWLEAGAYFYVCGDAQRMARDV
DAALRVIVAEHGRMDAAAAAAYVEGLSKARRYRRDVY
Download sequence
Identical sequences gi|26988435|ref|NP_743860.1| PpR342 160488.PP_1703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]