SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26988735|ref|NP_744160.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26988735|ref|NP_744160.1|
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.79e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26988735|ref|NP_744160.1|
Sequence length 181
Comment cytochrome B561 [Pseudomonas putida KT2440]
Sequence
MVSSPPTTHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSAERNLMKDLHFMLGLSVF
VLVWLRLAMRLSRPTPPIVPKPPAWQTGLAHLMHLALYLMMIGLPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences Q88LC5
160488.PP_2010 NP_744160.1.35174 WP_010953021.1.28295 WP_010953021.1.28475 WP_010953021.1.3142 WP_010953021.1.58218 WP_010953021.1.71439 WP_010953021.1.87606 gi|26988735|ref|NP_744160.1| GO.814 GO.8577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]