SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26990818|ref|NP_746243.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26990818|ref|NP_746243.1|
Domain Number 1 Region: 219-685
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.35e-79
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00048
Further Details:      
 
Domain Number 2 Region: 81-213
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.72e-33
Family Ferredoxin domains from multidomain proteins 0.00027
Further Details:      
 
Domain Number 3 Region: 1-77
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.01e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.033
Further Details:      
 
Weak hits

Sequence:  gi|26990818|ref|NP_746243.1|
Domain Number - Region: 807-886
Classification Level Classification E-value
Superfamily ADC-like 0.000133
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26990818|ref|NP_746243.1|
Sequence length 904
Comment NADH dehydrogenase subunit G [Pseudomonas putida KT2440]
Sequence
MATIHVDGKALEVNGADNLLQACLSLGLDIPYFCWHPALGSVGACRQCAVKQYTDENDTR
GRIVMSCMTPASDGTWISIDDEESKAFRASVVEWLMTNHPHDCPVCEEGGHCHLQDMTVM
TGHNERRYRFTKRTHQNQDLGPFIAHEMNRCIACYRCVRYYKDYAGGTDLGVYGAHDNVY
FGRVEDGVLESEFSGNLTEVCPTGVFTDKTHSERYNRKWDMQFAPSICHGCSSGCNISPG
ERYGELRRIENRFNGSVNQYFLCDRGRFGYGYVNRKDRPRQPQLADGTKLGLDAALDKAA
DLLRGRTIVGIGSPRASLESNYGLRELVGAEYFYSGMEAGELARVRLALNVLNNSPLPVP
TLRDIEDHDAVFVLGEDLTQTAARVALAVRQATKGKAEAMAEAMKVQPWLDAAVKNIGQH
ALYPLFIASLAETKLDDVAEECVHAAPADLARIGFAVAHAIDPSAPAVAGLDDEAQALAQ
RIADALVAAKRPLVVAGTSLADPALIEAAANIAKALKLREKNGSLSLVVPEANSLGLAML
GGESVDAALDAVISGKADAIVVLENDLYARVPAAKVDAALAAAKVVIVADHSKTATVDRA
HLVLPAASFAEGDGTLVSQEGRAQRFFQVFDPQYLDSSIQIHEGWRWMHALRATLLNKPV
DWTQLDHVTSACAEAAPQLAGIVNAAPSAAFRIKGMKLAREPLRYSGRTAMRANISVHEP
RTPQDKDTAFAFSMEGYSGSAEPRQQVPFAWSPGWNSPQAWNKFQDEVGGHLRAGDPGVR
LIESQGDRLNWFNAIPGAFNPARGIWTAVPFFHLFGSEESSSRAAPVQERIPAAYVALAK
SEADRLGVNDGALLSLNVAGVALRLPLRINEELGAGLVALPKGLAGIPPAIFGASVEGLQ
EAAQ
Download sequence
Identical sequences Q88FH2
NP_746243.1.35174 WP_010954902.1.28295 WP_010954902.1.3142 WP_010954902.1.58218 WP_010954902.1.71439 WP_010954902.1.87606 gi|26990818|ref|NP_746243.1| 160488.PP_4124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]