SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26991659|ref|NP_747084.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26991659|ref|NP_747084.1|
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.26e-40
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26991659|ref|NP_747084.1|
Sequence length 183
Comment cytochrome B561 [Pseudomonas putida KT2440]
Sequence
MQLRNSPSRYGVVSIILHWGVALAVFGLFGLGLWMVGLDYYSPWRKAGPDLHKSIGLVLL
AVMLLRVVWRFISPPPPAPTNHGAVTRLAAKLGHLALYLGLFAVMVAGYLISTADGVGIP
VFGLFEVPALISDLPDQADVAGVVHLWLAWGLVIFAVLHALAALKHHFIDRDATLTRMLG
RKA
Download sequence
Identical sequences A0A179R1Z4 Q88D46
GO.8583 NP_747084.1.35174 WP_010955552.1.28295 WP_010955552.1.28475 WP_010955552.1.3142 WP_010955552.1.41 WP_010955552.1.58218 WP_010955552.1.675 WP_010955552.1.71439 WP_010955552.1.87606 gi|26991659|ref|NP_747084.1| 160488.PP_4982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]