SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26986786|ref|NP_742211.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26986786|ref|NP_742211.1|
Domain Number 1 Region: 353-371,453-655
Classification Level Classification E-value
Superfamily HAD-like 2.75e-46
Family Meta-cation ATPase, catalytic domain P 0.00057
Further Details:      
 
Domain Number 2 Region: 140-253
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.93e-24
Family Calcium ATPase, transduction domain A 0.003
Further Details:      
 
Domain Number 3 Region: 90-141,254-347
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.1e-19
Family Calcium ATPase, transmembrane domain M 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|26986786|ref|NP_742211.1|
Sequence length 665
Comment heavy metal translocating P-type ATPase [Pseudomonas putida KT2440]
Sequence
MKSLLERPDDQAGHEGHSHEHGGIFGMNTELIFALICGALLGAGALAGKLGLIDRLPLIL
YVSAYVFGGWFTTKEAVTNIRQKRFEIDSLMLLAAVGAASIGAWAEGALLLFLFSLGHSL
ESYAMGRAKKAIEALSKLAPATAIVRRANGTVEMPVELLVPGDVVIVRPNDRLPADGFVV
VGSSSINQAPVTGESVPVDKQPVPDAELARSKPDAVDAASKVFAGTINGETLIEVEVTRR
STESTLARVIKMVSEAEVRKSPTQRFTDRFQRIFVPLVLLLVVGLLFAGIFLDEPFRDSF
YRAMAVLVAASPCALAIATPSAILSGIARAARGGVLIKGGAPLEELGSLNAMAFDKTGTL
TEGRPRITDVIPIGGTQIEDLLNVAIAVESMSDHPLAAAIVRDGEEMIGTRRRFQAKNMS
NMIGRGVRAELDGQFVWIGKVEMFGTNGIPALSKAALEAAERLRQSGRTTMVVRRADKDL
GAIGLLDTPREGAKEALQKLREMGIERMVMISGDHNRVAEAVAKQVGLDEAWGDLMPEDK
VKAIKNLRLSAKVAMVGDGVNDAPAMASSSVGIAMGAAGSDVALETADIALMADDIRQLP
FAVGLSRHTRSIIHQNLFVSLGIVAILVPSTIMGLSIGAAVAIHEGSTLLVVFNALRLLA
YRRST
Download sequence
Identical sequences A0A059V046 A0A088NSF3 A0A0B5K7X4 A0A0C1HUC7 A0A0W0N8B1 A0A132GES5 A0A136QDH2 A0A173HMT2 A0A1F1Q0G9 A0A1H3RXK3 A0A246GYH2 A0A263SMH8 A0A292D1U9 A0A2D2M0P6 A0A2G2P0J5 A0A2G8MWQ0 A5VWH0 B0KF01 B1J3Z7 L0FCV2 Q88RT8 U5V755 V7D2M1 V9QNZ0 V9V733
gi|568190164|ref|YP_008962863.1| gi|568184794|ref|YP_008957504.1| NP_742211.1.35174 WP_010951452.1.100418 WP_010951452.1.10374 WP_010951452.1.1079 WP_010951452.1.13892 WP_010951452.1.17606 WP_010951452.1.18387 WP_010951452.1.23231 WP_010951452.1.23948 WP_010951452.1.27009 WP_010951452.1.28157 WP_010951452.1.28219 WP_010951452.1.28354 WP_010951452.1.30459 WP_010951452.1.3142 WP_010951452.1.32932 WP_010951452.1.33269 WP_010951452.1.33725 WP_010951452.1.34630 WP_010951452.1.35335 WP_010951452.1.35996 WP_010951452.1.41 WP_010951452.1.48716 WP_010951452.1.52680 WP_010951452.1.54338 WP_010951452.1.5613 WP_010951452.1.57632 WP_010951452.1.58218 WP_010951452.1.60844 WP_010951452.1.62773 WP_010951452.1.62816 WP_010951452.1.63116 WP_010951452.1.6330 WP_010951452.1.65540 WP_010951452.1.65739 WP_010951452.1.66214 WP_010951452.1.71439 WP_010951452.1.71677 WP_010951452.1.72006 WP_010951452.1.72310 WP_010951452.1.7435 WP_010951452.1.76632 WP_010951452.1.78345 WP_010951452.1.79655 WP_010951452.1.80759 WP_010951452.1.81634 WP_010951452.1.83615 WP_010951452.1.83830 WP_010951452.1.87386 WP_010951452.1.90874 WP_010951452.1.9252 WP_010951452.1.96571 WP_010951452.1.96783 WP_010951452.1.99808 gi|148545312|ref|YP_001265414.1| gi|557220775|ref|YP_008760990.1| gi|26986786|ref|NP_742211.1| gi|431800062|ref|YP_007226965.1| gi|170719245|ref|YP_001746933.1| gi|167031076|ref|YP_001666307.1| 160488.PP_0041 351746.Pput_0055 390235.PputW619_0058 76869.PputGB1_0055 NYSGXRC-22046c gi|568137021|ref|YP_008929606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]