SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26987058|ref|NP_742483.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26987058|ref|NP_742483.1|
Domain Number 1 Region: 110-252
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.36e-37
Family Reductases 0.037
Further Details:      
 
Domain Number 2 Region: 15-119
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.7e-27
Family Ferredoxin reductase FAD-binding domain-like 0.0035
Further Details:      
 
Domain Number 3 Region: 245-367
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.9e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|26987058|ref|NP_742483.1|
Sequence length 368
Comment oxidoreductase FAD-binding domain-containing protein [Pseudomonas putida KT2440]
Sequence
MNMSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPIMFFFKPGQFVTLEL
EIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMHEGAELPVHGPVGLFNA
IDFPAGKVLYLSGGVGITPVMSMARWFYDTNANVDMVFVHSARSPKDIIYHRELEQMASR
IPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYMERVVFCCGPTPYMTAVKRMLE
AVGFDMKNYHEESFGATPPEAKADAVEHAEQAADAPELDVSDLNLVEFIGSEKSIRIAPG
ETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVEMEHNGGITEEDEAEGYILSCCSVP
KGDVRIDY
Download sequence
Identical sequences Q88R18
NP_742483.1.35174 160488.PP_0316 gi|26987058|ref|NP_742483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]