SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26987233|ref|NP_742658.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26987233|ref|NP_742658.1|
Domain Number 1 Region: 80-405
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.36e-47
Family Cystathionine synthase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26987233|ref|NP_742658.1|
Sequence length 475
Comment selenocysteine synthase [Pseudomonas putida KT2440]
Sequence
MSNSLASDTPRLPSIDTLLRHPACLPLIDRHGRDAVLNTLRQLLDDLREPARNGELGSAE
LAPEILLGRSGERLALQQRSQVRRVFNLTGTVLHTNLGRALLPDEAIEAMQTAARYPLNL
EFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVLLALNSLGARKEGIISRGELI
EIGGAFRIPDIMARAGVKLHEVGTTNRTHARDYEAAIGPRTGLLMRVHCSNYSIQGFTTQ
VPTAELARIAHQHELPLLEDLGSGSLLDLTRWGLPAEPTVRQALADGADIVTFSGDKLLG
GPQAGIIVGHKDLITRIKKNPLKRALRVDKITLAALEAVLALYRNPDRLAERLPSLRLLT
RSQAEIQAQAERLAPELQARLGEQWAISVEPALGMIGSGSQPVARLPSAALCLRPQVSKK
LRGRSLHVLERALRDLPVPVLGRIDDDALWLDLRQLDDEAQWLAQLPALQLGPVQ
Download sequence
Identical sequences Q88QJ8
160488.PP_0493 gi|26987233|ref|NP_742658.1| NP_742658.1.35174 WP_010951785.1.28295 WP_010951785.1.28475 WP_010951785.1.3142 WP_010951785.1.58218 WP_010951785.1.71439 WP_010951785.1.87606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]