SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26987967|ref|NP_743392.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26987967|ref|NP_743392.1|
Domain Number 1 Region: 279-447
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000206
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26987967|ref|NP_743392.1|
Sequence length 478
Comment hypothetical protein PP_1232 [Pseudomonas putida KT2440]
Sequence
MNLLRPTLLTLACLMALPGHADDLPSLGDASSAIVSPQQEHQLGRAWLSLLRGQVNQLND
PQLKDYVETSVYKLAETSQLQDRRLEFILIDSRELNAFAAPGGIVGVNGGLFLNAQTEGE
YASVLAHELAHLSQRHFARGVEAQQRMQLPMMAALLAGIVLAAGGAGDAGIGMIAGTQAA
AIQEQRRFSRQNEQEADRIGIQNLEKAGYDPRNMPTMFERLARQYRYDAKPPEFLLTHPV
TESRIADTRNRADQAPKGGIEDSMRYQLIRARVALIYEGTPGLAAKRFRAQLDEDPKLDA
ARYGLALAQVKGGQLNEAREMLKPLLAKAPNDITYNLAQIDLDITNNRLADAQQRAERMQ
GLYPGNYPLKQVRADLLVKQNKPAEAEKVLNELVKSRPDDPDVWYDMAEVRGLSGNTIGL
HRARAEYFTLVGDFDQAIQQLDYAKRRAGGNFPLASQIDQRQREIMEQRRMVQEMMGR
Download sequence
Identical sequences Q88NH7
NP_743392.1.35174 WP_010952374.1.28295 WP_010952374.1.28475 WP_010952374.1.3142 WP_010952374.1.58218 WP_010952374.1.71439 WP_010952374.1.87606 160488.PP_1232 gi|26987967|ref|NP_743392.1| PpR182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]