SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26988684|ref|NP_744109.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26988684|ref|NP_744109.1|
Domain Number 1 Region: 211-316
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.33e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0032
Further Details:      
 
Domain Number 2 Region: 97-224
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.31e-24
Family Aromatic dioxygenase reductase-like 0.004
Further Details:      
 
Domain Number 3 Region: 2-99
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.94e-24
Family Ferredoxin reductase FAD-binding domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26988684|ref|NP_744109.1|
Sequence length 317
Comment Pdr/VanB family oxidoreductase [Pseudomonas putida KT2440]
Sequence
MQNWLELEISRREKATEAISVFELRHPNGEKLPAFTAGAHIDVKVRDGLVRQYSLSNDPV
ETDRYVIAVLNEPTSRGGSRAIHEQFLQGMKISVGEPRNHFPLLDADDHFVLVAGGIGVT
PILAMARYLNRIGRSFEIHYCIRSRSTGAFLDVFQGPEFAGRVTLHVDDDPESTPLELAR
VLDKERARLYVCGPGGFMNWVLSTAEGCLSPERVHKESFSAEPIAAATDDGFEVEVASTG
QVFFIPTERSITEVLEEAGVEVLVSCQQGICGSCITNVLEGEPDHRDSVLSESERKSGKV
FTPCCSRSKSPRLVLDL
Download sequence
Identical sequences Q88LH5
160488.PP_1957 gi|26988684|ref|NP_744109.1| NP_744109.1.35174 WP_010952977.1.3142 WP_010952977.1.58218 WP_010952977.1.71439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]