SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26988909|ref|NP_744334.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26988909|ref|NP_744334.1|
Domain Number 1 Region: 243-777
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.36e-194
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000237
Further Details:      
 
Domain Number 2 Region: 783-925
Classification Level Classification E-value
Superfamily ADC-like 1.04e-40
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 99-236
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.55e-36
Family Ferredoxin domains from multidomain proteins 0.0076
Further Details:      
 
Domain Number 4 Region: 26-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.22e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|26988909|ref|NP_744334.1|
Sequence length 960
Comment formate dehydrogenase subunit alpha [Pseudomonas putida KT2440]
Sequence
MINFFDPASDKSSDLGTPARESDVQVSLSIDGRAISVPAGTSVMRAAAMLGTSIPKLCAT
DSLEAFGSCRMCMVEIEGMRGYPASCTTPVSEGMVVRTETPRLAGLRRNVMELYISDHPL
DCLTCSANGNCELQTVAGQVGLREVRYGYDGANHLDEKKDVSNPYFDYEPSKCIVCSRCV
RACEDIQGTFALTITGRGFESRVAAAGGENFLASECVSCGACVQTCPTATLTEKSLVQLG
QPERSVITTCAYCGVGCSFRAEIKGDQLVRMVPDKNGGANHGHACVKGRFAWGYATHPDR
ITKPMIRKRLEDPWQEVSWDEAVTYAASEFRRIQLKYGRDSIGGITSSRCTNEEAYLVQK
LVRTAFGNNNVDTCARVCHSPTGYGLKQTLGESAGTQSFDSVMQADVVLVIGANPTDAHP
VFGSQLKRRLRQGARLIVIDPRRIDLVDSPHARADLHLQLRPGTNVAMLNALAHVIVTEG
LLAQSFIDARCETGDFARWRDFVSLPDNAPEVLGPVCGVPAEQIRAAARLYATGGNAAIY
YGLGVTEHSQGSTAVMGIANLAMATGNIGREGVGVNPLRGQNNVQGSCDMGSFPHELPGY
RHVSNEGVRAEFEQAWGVTLQPDPGLRIPNMFEAALDGSFKALYCQGEDIAQSDPNTQHV
TAALLAMECVVVQDIFLNETAKFAHVFLPGSSFLEKDGTFTNAERRISRVRKVMEPLAGK
ADWEATVALANALGYPMNYRHPSEIMDEIARLTPTFRRISYAELDRHGSLQWPCNDAAPD
GTPTMHIDQFVRGKGRFMLTGYVPTDEKVNNRYPLLLTTGRILSQYNVGAQTRRTGNVAW
HDADRLEIHPTDAESRGIQDGDWVGIGSRAGQTVLRAKVSTRVAPGVVYTTFHFPESGAN
VITTDNSDWATNCPEYKVTAVEVVKVFQPSQWQKRYQDFSDEQQRLLKERRTAEKAEVRR
Download sequence
Identical sequences Q88KV4
NP_744334.1.35174 WP_010953170.1.28295 WP_010953170.1.28475 WP_010953170.1.3142 WP_010953170.1.58218 WP_010953170.1.71439 WP_010953170.1.87606 gi|26988909|ref|NP_744334.1| 160488.PP_2185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]