SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|26989927|ref|NP_745352.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26989927|ref|NP_745352.1|
Domain Number 1 Region: 206-312
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.29e-25
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.03
Further Details:      
 
Domain Number 2 Region: 104-219
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.28e-23
Family Aromatic dioxygenase reductase-like 0.0054
Further Details:      
 
Domain Number 3 Region: 2-98
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.42e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26989927|ref|NP_745352.1|
Sequence length 314
Comment Pdr/VanB family oxidoreductase [Pseudomonas putida KT2440]
Sequence
MSWTPLQVRALRLEADDVLGVELAPPGPAPLPFDWAPGAHVDLRLGNGAVRQYSVVSLPE
DGHVYLGIKREKASRGGSQWLHEHLRLGARVEVGLPRNLFSLQPGTGQVVLVAAGIGITP
LLAMYRQCQAQGRSVRLLFFTRDAEQVPFIQYLDANTEVHAGLRAPMITGYLEEHLPAWD
GSASLYCCGPAGFMACVERVALASGWPTTALHREHFQASEPTLHVERHCTLVLQRSRLQV
EVQPGESLVQAASRAGVELPVSCGMGICGACVSRVIEGAPDHRDEYLSDAQRNSGEWITP
CVSGCHSARLVLDV
Download sequence
Identical sequences Q88HZ4
NP_745352.1.35174 WP_010954093.1.28295 WP_010954093.1.28475 WP_010954093.1.3142 WP_010954093.1.58218 WP_010954093.1.71439 WP_010954093.1.87606 gi|26989927|ref|NP_745352.1| 160488.PP_3208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]