SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|26991942|ref|NP_747367.1| from Pseudomonas putida KT2440

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|26991942|ref|NP_747367.1|
Domain Number 1 Region: 201-245,277-510
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.45e-46
Family CoA transferase alpha subunit-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|26991942|ref|NP_747367.1|
Sequence length 597
Comment acetyl-CoA hydrolase/transferase [Pseudomonas putida KT2440]
Sequence
MGLPLGLGKPNAFVNALYARVRELPERRLTIYTALSLGRPPLGDGLQRRFLEPFVERVFA
DYEELSYLADLRNDTLPPNIRVEQFFMQPGSLLHSESAQQDYVSSNYSHAARDINAKGLN
LIAQLVAATPEKPVHLSLACNPDITLDLLPMIAKRRAAGETILMLGQVHAELPYMPGDAE
LPIDAFDLLLDEVEQRRLFSTPNMPVGIQDHCIGLHASSLVRDGGTLQIGIGAMGDAVAA
ALLARQGDNAGYRAVLKALDVGPWQALIEREGGLDTLTHGLYGCSEMFVNGLLVLAEAGL
LRRPADEQGAILHGGFFLGPQAFYQRLREMPLEQRAQFVMTRISFINELYGQEALKRRQR
RDARFINTAFGMTLLGAGVADQLEDGRVLSGVGGQYNFVAQGHALEGGRSILLLRSWREA
GGEVTSNLFWTYGHCTIPRHLRDIVVTEYGIADLRGQTDSEVIARLLAVSDSRFQPGLIK
QAKDAGKLADDFQLEARFTDNTPQRLEAIRAQHARLFPEYPMGTDFTAEERDLLRALNWL
KSKFKLSEVLELGKAALDAPGPEGYESHLGRMQLGQPQGLKEELYQRLLLAGLAATR
Download sequence
Identical sequences gi|26991942|ref|NP_747367.1| 160488.PP_5266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]