SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s25670.1|PACid:18234411 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s25670.1|PACid:18234411
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily TSP9-like 1.57e-25
Family TSP9-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s25670.1|PACid:18234411
Sequence length 92
Sequence
MASLPIAFAVPSVRVYAATAAKGAGGGKEEKGLLDWIIGSLQKEDQFYETDPILKKVEGK
NNGGTASGRKNSVAVPQKKKSGGFGGLFAKND
Download sequence
Identical sequences A9PGC5
POPTR_0001s25670.1|PACid:18234411 XP_002298321.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]