SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0014s19050.1|PACid:18223810 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0014s19050.1|PACid:18223810
Domain Number 1 Region: 491-658
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.22e-42
Family BRCA2 helical domain 0.00055
Further Details:      
 
Domain Number 2 Region: 659-788
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-35
Family Single strand DNA-binding domain, SSB 0.00021
Further Details:      
 
Domain Number 3 Region: 791-820,940-1025
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-24
Family Single strand DNA-binding domain, SSB 0.0068
Further Details:      
 
Domain Number 4 Region: 826-940
Classification Level Classification E-value
Superfamily BRCA2 tower domain 7.26e-16
Family BRCA2 tower domain 0.0045
Further Details:      
 
Domain Number 5 Region: 1032-1166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000386
Family Single strand DNA-binding domain, SSB 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0014s19050.1|PACid:18223810
Sequence length 1186
Sequence
MSSWKIFSDSGNNFRWEVTGQIIHTKPEPKQSGALIPPSSSKTHLPSMADLLLQGCPKLL
ENGNAPIFRTGSGKSVALKQSSIAKALSVLRDDDDAGEACGGENELSFSKLRKKGNEDNG
NAPIFHTGSGKSVVLKQSSIAKALSVLGDDDGYSGNPGEVHGRNNERCFSNSLFHTGSGK
SVDISSAGLVRAKRLLGMEEENYSSNFQGFKCPRKSSTVNEQFGWQDVMHSGTKVSMKNN
GVIGDDLPAPRSSLVSKTVILESELTKEVNTNLLEPEIQKPPPIKFHTAGGRSLSVSSEA
LKRARSLLGDPDLGTFLNEGDAVDQGLSVFEGSGFGDASSNKENVFYSAFTHPRASSKHI
SKTFISPLKSSANYVQSSINPKNVISGSNLIKKFDAVHNDSISKVNNNATYVQKPVRNGL
CTSATMVANSLDNITGSRMNSLQRTSSRMIPLQKSLCAPLPDISNTIGTAYSNNGQANGE
KRKLGRGISISPFKKPRSSKFTTPLNRNVSSVPSGLSTVSYESSSCRKKVSTRYPFQVPR
MYIKEYFGGHLSDKRLSEYFTDQVRQIKSNNADKYMFCDESGRDSIGAEAFYDMLLQSGA
LSQYASKEWVINHYKWIVWKLACYERCCPEKSAAKFLSVSNVLEELKYRYEREVNHGHRS
AIKRILEGDAPPSSMMVLCISSIYFGCEPKVEVPSVALDGAEHSNAAKLELTDGWYSVDA
LLDISLSMHLDAGKLFVGQKLRIWGAGLCGWAGPVSSFEALKTVSLSLHINGTYRAHWAA
RMGFCKGIGAPLAFRCIKSNGGPVPRLLVGVTRVYPVLYKDKLSNGSRTIVRSERMEAKL
VQLNNQRRSVIIEGIVSEFQRGMKSSNIYTDIDSEEGAKIFKILETSAEPEVLMAEMSPQ
QLASFASYQSKLEATRQLDMEKAIGKALQDAGLGEREVTPFIRVRVVGLTNYQEKGARAP
KEGLITIWNPTEKQKSDLVEGQAYAVAGLLPVSSDSNTLYLQARGSTTKWQPLSSLAMQQ
FQPFFSPRAPVLLSNLGEVPLCREFDIAALVLHVGDIYTAAQQKKQWVFVTDSSISRFDS
EDTSKSLLAISFCSPYMDNDSFTPINYNLAGSTIGLCNLIKRAKDQTYHLSIAEATENST
YSLNFDSSNFLHLKNAAASTQSWAKTSTSVNNLDFDYDSSALVYNA
Download sequence
Identical sequences B9IB91
POPTR_0014s19050.1|PACid:18223810 XP_002320595.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]