SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s03570.1|PACid:18237985 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s03570.1|PACid:18237985
Domain Number 1 Region: 64-169
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.83e-20
Family N-acetyl transferase, NAT 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s03570.1|PACid:18237985
Sequence length 408
Sequence
MSLRIAADNFPTLPVGEMENFVVVREYDEGRDKVAVEEMERSCEVGQRGKHSLVTDLMGD
PICRVRRFPSHVMLVAECGDGGEIVGVIRACVNTVRTRESSGYVKLAYILGLRVSPSHRR
LGIGTKLVQEIEEWCKQKGAEYSYMATDCSNEPSINLFTRKCFYTKFRTLTMLVQPVHAH
YKPLGSGIAIIQLPPKLAEAIYCRVFADAEFFPKDIGTILSSKLNLGTFMAVPKKALPKW
DPKTGILPSSFALLSVWNTKEVFKLQVKGVSKLTYACCTGTRLLDAWMPWLRLPSFPDVF
RQFGVYFLYGLHMEGKNASRLMKALCAFAHNMARDDDGCGAVVAEVAQRDPVREVIPHWR
RFSWAEDLWCIKKLADEKLDDVDRRCGQSDWMKHGSSSPVIFVDPRDI
Download sequence
Identical sequences B9GMA0
POPTR_0001s03570.1|PACid:18237985 XP_002299247.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]