SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s10900.1|PACid:18237034 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s10900.1|PACid:18237034
Domain Number 1 Region: 125-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-40
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 491-574
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000422
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s10900.1|PACid:18237034
Sequence length 610
Sequence
MMAMNRGIGGGGGGGSLSQGNSEGCGGDDLYTELWKACAGPLVDVPKRGERVFYFPQGHM
EQLEASTNQELNQRVPLFNLPSKILCRVIHTQLLAEQDTDEVYAQITLIPESDQIEPTSP
DSSSSEPPRPTVHSFCKVLTASDTSTHGGFSVLRKHATECLPPLDMTQPTPTQELVAKDL
HGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFLRGENGELRVGVRRVACQQ
SSMPSSVISSQSMHLGVLATASHAVSTLTLFVVYYKPRTSQFIISLNKYLEAVSNKFVVG
MRFKMRFEGEDSPDRRFSGTIVGVEDFSPHWNDSKWRSLKVQWDEPAPIPRPDRVSPWEI
EPCVASVPTNLSQPVTQKNKRPRPPFEIPALGYSTPLSSKSKNDAILDPSDKGRKSEVPT
SYRLFGIDLVNHSSSSTPIEVPAQLMSICSGATEGHVLGTLSAVDSDQKSEVSKEQKPEQ
LQKSPKEIQSKQSSTSTRSRTKVQMQGIAVGRAVDLTMLKGYSQLIDELEQLFDIKGQLH
PRDKWEIVYTDDEGDMMLVGDDPWPEFCNMVRRIYICSSQDVKRMGPGSKLPKLPIKGEG
TVLSSDSAEN
Download sequence
Identical sequences U5GP47
POPTR_0001s10900.1|PACid:18237034 XP_006368789.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]