SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s10900.2|PACid:18237035 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s10900.2|PACid:18237035
Domain Number 1 Region: 125-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.09e-40
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 470-553
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000407
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s10900.2|PACid:18237035
Sequence length 595
Sequence
MMAMNRGIGGGGGGGSLSQGNSEGCGGDDLYTELWKACAGPLVDVPKRGERVFYFPQGHM
EQLEASTNQELNQRVPLFNLPSKILCRVIHTQLLAEQDTDEVYAQITLIPESDQIEPTSP
DSSSSEPPRPTVHSFCKVLTASDTSTHGGFSVLRKHATECLPPLDMTQPTPTQELVAKDL
HGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFLRGENGELRVGVRRVACQQ
SSMPSSVISSQSMHLGVLATASHAVSTLTLFVVYYKPRTSQFIISLNKYLEAVSNKFVVG
MRFKMRFEGEDSPDRRFSGTIVGVEDFSPHWNDSKWRSLKVQWDEPAPIPRPDRVSPWEI
EPCVASVPTNLSQPVTQKNKRPRPPFEIPALGYSTPLSSKSKNDAILDPSDKGRKSEVPT
SYRLFGIDLVNHSSSSTPIEVPAQLMSICSVSKEQKPEQLQKSPKEIQSKQSSTSTRSRT
KVQMQGIAVGRAVDLTMLKGYSQLIDELEQLFDIKGQLHPRDKWEIVYTDDEGDMMLVGD
DPWPEFCNMVRRIYICSSQDVKRMGPGSKLPKLPIKVVFGLRGWFKLERQEALAD
Download sequence
Identical sequences B9GL31
XP_002299455.2.11743 POPTR_0001s10900.2|PACid:18237035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]