SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s21290.1|PACid:18238788 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s21290.1|PACid:18238788
Domain Number 1 Region: 282-301,355-564
Classification Level Classification E-value
Superfamily HAD-like 3.05e-43
Family Meta-cation ATPase, catalytic domain P 0.0017
Further Details:      
 
Domain Number 2 Region: 84-172
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.53e-24
Family Calcium ATPase, transduction domain A 0.0042
Further Details:      
 
Domain Number 3 Region: 38-70,173-276
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000105
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s21290.1|PACid:18238788
Sequence length 569
Sequence
MDEEILYKLKKFQHHWGACSPFPLISGGWKAFFEEPIMLIAFVLLGRNLEQRAKIKATSD
MTGLLSVLPTKARLVVNGDAKDLGSIVEVPCSSLSVGDKIVVLPGDRVPADGTVTAGRST
IDESSFTGEPLPVTKLPGSQVSAGSINLNGTLTIEVKRPGGETAMGDIVRLVEEAQSREA
PVQRLADKVSGHFTYGVMTISAATFVFWSMFGTRILPAALNQGNPISLALQLSCSVLVVA
CPCALGLATPTAVLVGTSLGATRGLLLRGGNVLEKFSMVNSVVFDKTGTLTIGRPAVTKV
VPLGGMKITDSQLNPDATLSEVELLKLAAGVESNTIHPVGKAIVEAAQAAGCQNVKVTDG
TFMEEPGSGAVATIENKVVSIGTLDWIQRHGVDEKPFQEVEDLKNQSVVYVGVDNTLAGL
IYFEDQIREDARQVVESLSSQGINVYMLSGDKKSTAEHVASLVGIPKEKVLSGVKPDEKK
RFISELQKDQSIVAMVGDGINDAGALAESHVGVAMGGGVGAASEVSSIVLMGNRLSQVLD
ALELSRLTMKTVKQNLWLEFRLQLECYCQ
Download sequence
Identical sequences B9GF99
XP_002299685.2.11743 POPTR_0001s21290.1|PACid:18238788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]