SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s32990.1|PACid:18237627 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s32990.1|PACid:18237627
Domain Number 1 Region: 105-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-20
Family B3 DNA binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s32990.1|PACid:18237627
Sequence length 297
Sequence
MAGGEGVTVEGDNKQSPNIEGGSDLVIRGSTRDHLVGSMVGFEIKRKKRMPRQRRSSSTI
NHLLSFAANASCSATTHLHVPAFSLPLQDPSSLPARVIDPRRLRFLFQKELQNSDVSSLR
RMILPKKAAEVHLPFLESKEGIFISMDDLDGLHVWSFKYSRYWPNNNSRMYVLENTGDFV
NAHGLQLGDFIMVYQDSQSQNYVIQAKKASDQNVYSDIARNAVNDTVLHDYEVNKFSSFY
VNYPVVDNTGLSFIYDTTTFSNYSPLDFLGGSMTNFSRIGHLESFGSVENMSLDDFY
Download sequence
Identical sequences B9GFH6
POPTR_0001s32990.1|PACid:18237627 XP_002298665.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]