SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0001s45650.1|PACid:18239318 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0001s45650.1|PACid:18239318
Domain Number 1 Region: 107-198
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.4e-29
Family B3 DNA binding domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0001s45650.1|PACid:18239318
Sequence length 445
Sequence
MEFGTGFSEGDQMSRGKGLPFSSYSSSNSSPSSSSSQQRNQLVLGQIYENHQIGSWLGNK
YDQVDQDTSRFNESVAVNAAKLDLMDVNDEEEGGRGESSSVQVIEKEHMFDKVVTPSDVG
KLNRLVIPKQHAEKYLPLDSSSNEKGLLLNFEDMNGKAWRFRYSYWGSSQSYVMTKGWSR
FVKEKKLDAGDIVSFQRGVGELGKDRLYINWRRRPDAPDDPSRHQHHFHNHHFSAIPWSP
LLMRPPTVPVLPRDHLHLSNPNRNTCYKVGGSSYGYGYGNYSNVVNPCSSSGSVFYMTSS
AGAGAALEPAPQQVGMGMVQWQLGGGGVVEPVVYESVPVVQGKAAAKRLRLFGVNMDCPI
TDQSDDYGHKLSSTTAAATTLPHNATIALQPTPQLSSQSLQHPLHQLRLYRGTPLAAMPP
STTQFLHKGKSSSPSSSSMSLDLDI
Download sequence
Identical sequences U5GXP9
POPTR_0001s45650.1|PACid:18239318 XP_006370733.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]