SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s02630.1|PACid:18245091 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s02630.1|PACid:18245091
Domain Number 1 Region: 134-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-46
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 832-898
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000285
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s02630.1|PACid:18245091
Sequence length 933
Sequence
MGSAEEKIKTGGIINGAQTNLLEEMKLLKEFQDQSGTRKAINSELWYACAGPLVSLPQVG
SLVYYFPQGHSEQVAVSTKRSATSQIPNYPNLPSQLLCQVHNVTLHADKDTDEIHAQMSL
QPVNSEKDVFPVPDFGLKPSKHPSEFFCKALTASDTSTHGGFSVPRRAAEKLFPPLDYSM
QPPSQELVVRDLHDNTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLKAGDSVLFIRNEKSH
LMVGVRHANRQQTTLPSSVLSADSMHIGVLAAAAHAAGNRSPFTIFYNPRACPSDFVIPL
IKFRKTVFGTQVSVGMRFGMMFETEESGKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWD
EPGCSDKQNRVSSWEIETPESLFIFPSLTSGLKRPLQSGFLGDTEWGGLVKKPLALLPGS
GNASLPYASMSNMYSEQLINMLMKPQAVNYPGICGTALPEVSAVKVASLDVKNMQAAINQ
TPQLNQSGITPIENQNYSQICLDQSNAMNSYSSKANVAGKSLSLSKVENQASVGGVDGKF
KAKPEHLPDQLSQPTSTGECIVQKPISCPMTQQNATNHLVFQNQNQGQSQLQASLWPMQA
LTESSLLNSQQIRASLADATTPNCSLPFLDAGEWISHPMSIDSMCRSGPLSMFGLQDPSL
PFMHQDAWDHQMSNLRILSEANQLIPLAQQEPCSFNSGAVKDSSDESNDQSGIYGSLNID
ASNGGGSVYDRSVSSAILDEFCTLKDADLQNASDCLVGNLSSSQDVQSQITSASLADSQA
FSRQDFPDNSGGTSSSNIEFDNSNLLQNNSWQQVAPRVRTYTKVQKTGSVGRSIDVSSFK
NYEELCSAIECMFGLDGLLNNPKGSGWKLVYVDYENDVLLIGDDPWEEFVGCVRCIRILS
PSEVQQMSEEGMKLLNSANIQGINTPITEGIHA
Download sequence
Identical sequences B9GQX6
POPTR_0002s02630.1|PACid:18245091 XP_002300719.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]