SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s17350.1|PACid:18246615 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s17350.1|PACid:18246615
Domain Number 1 Region: 107-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.11e-41
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 566-647
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000019
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s17350.1|PACid:18246615
Sequence length 686
Sequence
MAHAERGCDDLYTELWKACAGPLVDVPKDGERVFYFPQGHMEQLEASTNQELNQQIPRFN
LPPKILCRVVNIQLLAEQDTDEVYAQITLHPEVDQTEPTSPDPCPPEPAKPTIHSFCKIL
TASDTSTHGGFSVLRKHATECLPPLDMSQATPTQELAARDLHGFEWRFKHIFRGQPRRHL
LTTGWSTFVTSKRLVAGDAFVFLRGHNRELRVGVRRLARQQSSIPSSVISSQSMHLGVLA
TASHAVLTQTLFVVYYKPRTNQYIIGLNKYLEAVKNGFSVGMRFKMRFEGEDSPERRFTG
TIVGVGDISPEWSGSIWRSLKIQWDEPATIQRPERVSPWDIEPFAAPASPNLTQQVMKTK
RPRPTDIPTSAASSFWYHGSTQSHELAQLGSSNEVQSSESHVWSMRQKEIDTSLLNNSSS
SNTRARPEGIWPSSPNMNVSLNFFPDSVGDNNFATTRSIISGFSSPISSRQSNCLINEQV
EKGRKYENSVGCRLFGIDLTSNSGSSAPPEKEPGYPIVDSNGTKGLVPAASEAERAQAMD
VSMYSKEQKQVLSEAMVKESQSKQGSTTSMRTRTKVQMQGIAVGRALDLTVLKGYRDLIY
ELEKMFEIEGELSTPNKWAVVFTDDEGDMMLVGDDPWPEFCKMVKKIFIYSSEEVKKTGT
RCKLPASSFEGEETVVSMDSDHRSDA
Download sequence
Identical sequences U5GT51
POPTR_0002s17350.1|PACid:18246615 XP_006386630.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]