SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0002s25330.1|PACid:18244722 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0002s25330.1|PACid:18244722
Domain Number 1 Region: 576-670
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.53e-22
Family B3 DNA binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0002s25330.1|PACid:18244722
Sequence length 718
Sequence
MKGLEVHGEDRHEGVENEGNPTIGFDAMEEEQDILVEDKEIWLERGQEDLLHASDVSIFY
EDFPPLPDFPCMSSSSSSSSTPAPVNAITSSSSSSCSSSASSSSSAAAWAVLKSEAEEDV
EKNHQHPMDDPVDVSTAALSSTCSMEVPQPPDQAMELGIECMDVMEDFGYIDLLESNDFF
DPSSIFHPDEGIFEEFQMEQNEPQDQLQLQYDEQAGNEEITKGKNDQEADHQGGRSDDLA
MVFLDWLKSNKETVSADDLRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQ
RRRMRESSSNVNLLYPYNQDPLQNQNPNPNSNLNCNPIPADHSNPCFTQSPWNVAPPPYL
AADPATVMPGFSPMVGFMGDPFSNGSSNINGHPYGTPQDCNHMLQSYQTWPPSQFHSASH
FNSFADNNLQSAQPQNPAFTGYGNQYPYQYVPANGDNRLTRLGSSATKEARKKRMARQRR
FLSYHRNQNHHNIQHQNQGAGDPHERLSDDPNGAPTGQSNPGSWVYWPTAAGGGSASTTV
DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAE
THLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFI
VIYSDVKCGKYLIRGVKVRQPAGPKPENKRAGKSQRNSHANCPAAANNGSGSQKQTVK
Download sequence
Identical sequences B9GR87
POPTR_0002s25330.1|PACid:18244722 XP_002303088.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]