SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s14200.1|PACid:18217325 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s14200.1|PACid:18217325
Domain Number 1 Region: 67-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-39
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 2 Region: 430-512
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000638
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s14200.1|PACid:18217325
Sequence length 548
Sequence
MEQLEASTNQELNQRVPLFNLPSKILCRVINTQLLAEQETDEVYAQITLLPESDQIETTS
PDPCPSEPPRPTVHSFCKVLTASDTSTHGGFSVLRKHASECLPPLDMIQPIPTQELVAKD
LHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFLRGENGELRVGVRRVARQ
QSSMPSSVISSQSMHLGVLATASHAISTLTLFVVYYKPRTSQFIISLNKYLEAVNNKFAV
GMRFKMRFEGEDSPERRFSGTIVGVEDFSPHWNDSKWRSLKVQWDEPASISRPDRVSPWE
IEPCVASVPANLSQPVQPKNKRPRPPIEIPAFAMEDSKSVSPWPVFVGYSTPLSSKSKND
PIPDPSNKGRKYEVPTSYRLFGFDLVNQSTSSSSPIEKVSAQPISVSRGATDGRVLAALP
AVDSDQKHEQSSTSTRSRTKVQLQGIAVGRAVDLTLIKGYGQLIDELEQLFDIKGQLHPR
DKWEIVYTDDEGDMMLVGDDPWPEFCNMVRRIFICSSQDVKKMSPGSKLPMLALEGEGTV
LSSDSAEN
Download sequence
Identical sequences B9GXS6
POPTR_0003s14200.1|PACid:18217325 XP_002303662.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]