SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0003s16210.4|PACid:18216423 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0003s16210.4|PACid:18216423
Domain Number 1 Region: 152-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-39
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0003s16210.4|PACid:18216423
Sequence length 671
Sequence
MELRAGAGVFRWLVKVPMIIHNDFLSFSFDFFRFYWIIAVVVLARVGSEDALYKELWHAC
AGPLVTVPRQGELVYYFPQGHIEQVEASTNQVADDQQMPAYNLSPKILCRVVNVQLKAEL
DTDEVFAQVILLPETQQDVELVEEEDLPPLPARPRVHSFCKMLTASDTSTHGGFSVLKRH
ADECLPPLDMSLQPPVQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSLFVSAKKLVAG
DAFIFLRGETEELRVGVRRALRQPSKIPSSLISSHSMHIGILATAWHAVSTGSMFTVYYK
PRTSPAEFIIPVDKYMESVKINYAIGMRFKMRFEADDAPEQRFSGTVIGVEEADPKKWPR
SNWRCLKVHWDETSPVHRPDRVSPWKVEPALAPSMDPVSGCRLKRHRPNTVTSSADSSAL
TKKDNGPSRHMQHQEILTLRNTPTGKNYSDNNHNPPWVLSQGTGTLLKSYESSRPFFGLF
SDDVDQPSKLTSDEKSMFNWHSAPMMYTGHPFNMLASSMEVQVAKDKDTQQQHGSRFLPF
PYADSSPHPSRSKPQHLPFQQCNERTAKDDNYKLFGVSLFRNSKALEPATIHRHSADKPQ
HQINVASDHLQLLGSDRYLEQLKHPKHARCEEQENIFQASSLYSKDVQGKPEGGSARRCV
KVVTYFNAVIE
Download sequence
Identical sequences U5GJI7
POPTR_0003s16210.4|PACid:18216423 XP_006385883.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]