SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s00800.1|PACid:18226450 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s00800.1|PACid:18226450
Domain Number 1 Region: 40-264
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.36e-75
Family "Hypothetical" protein ybl036c 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s00800.1|PACid:18226450
Sequence length 272
Sequence
MNRQEEEEPSTTDKNCTTIQEQEQVSDMSAIPVAMDKVAAAALRSVLQRVSQAAEKAGRG
SQQIRVVAVSKTKPVSLIKQVYDVGHRCFGENYAQEFIEKAPQLPEDIEWHFIGNLQSNK
VKPLLASVPNLDMVESVDDEKIANHLDRAVGNLGRKPLKVLVQVNTSGEESKSGVEPSGC
VELAKHVIQSCTNLQFCGLMTIGMLDYTSTPENFKALANCRSEVCKALGIPEEQCELSMG
MSNDFEQAIEMGSTNVRIGSTIFGPREYPKKK
Download sequence
Identical sequences U5GDQ4
XP_006383876.1.11743 POPTR_0004s00800.1|PACid:18226450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]