SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s04560.1|PACid:18226255 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s04560.1|PACid:18226255
Domain Number 1 Region: 166-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000124
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s04560.1|PACid:18226255
Sequence length 305
Sequence
MGCPQNSQFSSMYGPLSYHSTVPSNSVTQSNCVPPQYYMPAPCESRQNPYTHSLEKPSHH
TPSADPFRLAMAGQNAFEMQRSCILQPNAFQLEQERRALDAYKTKVARCKRKLARQRSLS
KTSIGASSTQIMDARRLALHGASTCGQRSRSNTSKDLYEFLTPDNKREVEENLPVLNDKE
GILLFLRDVYSNQEWALKFKFWSNNKSRMYVLENTGEFVKQNGLETGDFLTLYEDESKNL
PINHNSNCLYTPHMYQARDEEKSSLALLIEQLDQKEQEEANSLVAVPPDSAYTNNELTNN
PFNNS
Download sequence
Identical sequences U5GHQ5
XP_006384034.1.11743 POPTR_0004s04560.1|PACid:18226255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]