SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s09870.1|PACid:18226830 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s09870.1|PACid:18226830
Domain Number 1 Region: 67-178
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.22e-16
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s09870.1|PACid:18226830
Sequence length 188
Sequence
MEKHGGFGRGEVPWNQPRNKESAEELERSRVAFNLRRMRTSYTLGDLLEESSRGVSTHLS
LYHHYDPFTIKKKMKPSDLGNLCRLLVPSDLVEKYILPFLNTDQIKQVNQETNLGLKVSV
WDMNTQSMHQLVFKRWSTSRSYIFNDGWTKDFVRRRNLVEGDEIGLYWDTYHSRFNFNVL
SRAAAAAS
Download sequence
Identical sequences B9H2Z8
POPTR_0004s09870.1|PACid:18226830 3694.fgenesh4_pg.C_LG_IV000570 XP_002305818.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]