SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0004s22130.1|PACid:18224673 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0004s22130.1|PACid:18224673
Domain Number 1 Region: 109-215
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-29
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0004s22130.1|PACid:18224673
Sequence length 708
Sequence
MKKTDKKSLDPQLWQACAGSMVQIPPLNTKVFYFPQGHAEHSQSPVDFPQRIPSLVLCRV
ASVKFLADPGTDEVFAKISLVPLPDADLDISQDVDICGDGNDSNNAEKPASFAKTLTQSD
ANNGGGFSVPRYCAETIFPRLDYSADPPVQTLIAKDVHGEVWKFRHIYRGTPRRHLLTTG
WSTFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGVGIGSGPESSPSHIGWNSNNATSA
NPYGGFSLSVKEDEMRNGGVKGRGRVKSEEVLEAAGLAANGNPFQVVYYPRASTPEFCVK
ASSVRAAMRTCWCSGMRFKMAFETEDSSRISWFMGTVASVQVADPDRWPNSPWRLLQVTW
DEPDLLQTVKCVSPWLVELVSNMPVIHLSPFSPPRKKLRFPQQLDFPLDGQFQLPSFSGN
PLGPSSPLCCLSDNTPAGIQGARHAQFGISLSDFQFKKKLQSGLFLSSLQRFNPRTKNSE
NYPTGHPDSNKNLSCLLTKGSSNPKLEKSDNAKKHQFLLFGQPILVEQQISHSCSADAFP
QVVNERNSSDSNREKNSDVLRSAPGKQISQEKSCTTGFSWHQSLQNTSENGMDTGHCKAF
LESEDLGRTLDLSALHSYEELRRKLAIMFGIERSDMLSHVLYRDVTGAVKQIGDEPFSVF
MKTAKRLTILMNRASGNSVGRRTWITGMRNAENGLEAPNKTGPLSIFA
Download sequence
Identical sequences B9MZ57
XP_006384909.1.11743 3694.eugene3.00660262 POPTR_0004s22130.1|PACid:18224673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]