SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s22770.1|PACid:18208151 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s22770.1|PACid:18208151
Domain Number 1 Region: 260-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.91e-16
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 46-188
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000023
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s22770.1|PACid:18208151
Sequence length 586
Sequence
MENAIETTSSFSFDSSSYLSKGPSSHRVPIPDVPEPGVSLENFSLSKLSGNLERLLLDGE
YDYSDAEIVVEGIPVGVHRCILAARSQFFHELFKKVDSNSTSGDKPRYLMSDLMPYGGVG
YEAFNVFLHYLYTGKHKSSPPEVSQCVYDACAHDACRPAINYAVELMYASATFQMKELVL
LFQRRLLSFIDKALDEDVIPIVMAAFHCQLDQLLSLCIERLVRSDLDSVCIDKELPHEIS
SKVKLLRKKSLEEAESSVEEVDPMREKRMSRIHKALESDDVELVQLLLSESNFTLDDAYA
LHYAVSYCDPKVVKEVLALGLADLNLRNSRGYTVLHVAARRKESSILVALLAKGARASEI
TMDGRNAVSIWRSLTRPKDYNANTKQGQESNKDRICIEILETEMRRTSMSANISMISPDL
NMKPDDLEDRVAFARLFFPAEARLAKDMANADSTSMYTGLPASKSKGSSGDTREVDLNET
PSVQDKRLQLRLQELRKTVEMGRLYFPHCSEVLDKFLDDDVPDALYLDKGTPAEQKTKKM
RFLELKEDVQMAFNKDMEKNRSVLSSSSSFSSSPKSGVTRKARRKC
Download sequence
Identical sequences B9H850
POPTR_0005s22770.1|PACid:18208151 XP_002307566.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]