SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s23890.1|PACid:18206334 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s23890.1|PACid:18206334
Domain Number 1 Region: 452-544
Classification Level Classification E-value
Superfamily Bromodomain 7.06e-31
Family Bromodomain 0.00013
Further Details:      
 
Domain Number 2 Region: 210-367
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.2e-21
Family N-acetyl transferase, NAT 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s23890.1|PACid:18206334
Sequence length 564
Sequence
MDTHSHLTAPNRSRSSQSPSPSHSASASASASATSSIHKRKLAAAAAAYDDHLPPFAPSS
LSADTRDGALTSNDDLESISARGADSDSDDAEDSDTVLDDDEEDFDNDSSMRTFTTARLE
TTNAAGSSSRNTKIKMENTNVKIENSDSGKDGGHTGTGAVGPAAAGSSGPGIVVKEDSVK
IFTENLQASGAYSAREESLKREEEAGKLKFVCYSNDDVDEHMVWLIGLKNIFARQLPNMP
KEYIVRLVMDRSHKSVMIIRRNQVVGGITYRPYVSQRFGEIAFCAITADEQVKGYGTRLM
NHLKQHARDVDGLTHFLTYADNNAVGYFIKQGFTKEIYLEKDRWQGYIKDYDGGILMECK
IDQKLPYTDLSTMIRRQRQAIDEKIRELSNCHIIYPGIDFQKKEAGIPKKIIKVEDIPGL
REAGWTLDQWGHSRFRTLNTATDSATNQKHLTAFMRSLLKATQLNVKQSMHDHVDAWPFK
EPVDARDVPDYYDIIKDPMDLKTMSKRVESEQYYVTLEMFIADVKRMCANARTYNSPDTI
YYKLEAHFQSKVQSGIQSGTKILP
Download sequence
Identical sequences B9H8G2
XP_002306812.1.11743 POPTR_0005s23890.1|PACid:18206334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]