SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0005s25800.1|PACid:18206336 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0005s25800.1|PACid:18206336
Domain Number 1 Region: 134-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.22e-46
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 842-900
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000785
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0005s25800.1|PACid:18206336
Sequence length 914
Sequence
MGSVEEKIKTGGLANGAQTNLLEEMKLLKEFQDQSGIRKAINSELWYACAGPLVSLPQVG
SLVYYFPQGHSEQVAVSTRRSATSQIPNYPNLPSQLLCQVHNVTLHADKDTDEIYAQMSL
QPVNTEKDVFPIPDFGLRPSKHPSEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYTM
QPPTQELVVRDLHDNTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLKAGDSVLFIRDEKSQ
LMVGVRRANRQQTTLPSSVLSADSMHIGVLAAAAHATANRSPFTIFYNPRACPSDFVIPL
IKFRKAVFGTQVSVGMRFGMMFETEESGKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWD
EPGCSDKQNRVSSWEIETPESLFIFPSLTSGLKRPLQSGFLGDSEWGSLVKKPLSWLPGS
GNANLPYASMSNICSEQLINMLMKPHPINYPGICGAALPEVSAAKVASLDVKNMQATINQ
MPQLNQSGVTSVENQNYSQICLDQSDAIISSSLKINVAGKSFSSSEVENQASVGVGERKL
KAETEHLPDQLSQLTSTGECIVQKPSSCPMTQQNATNHLAFQNQNQGHSQLQTNLWPAQA
FPESSLLNSQQILSPLADATAPNCSLPFLDADEWISHPMSLAGMYRSGPLSMFGSQDTSV
VFPEAINPSLPFMNQDVWDHQMSNSTFLSQANQLISSTQQEPCTLNSGAVKDLSDESNDQ
SGIYGSLNFDASNGGGSVVDPSVSSAILDEFCTLKDADLQNASDCLVGNLSSSQDVQSQI
TSASLADSQAFSRQDFPDNSGGTSSSNVDFDNSNMLQNSSWQQVAPRVRTYTKVQKTGSV
GRSIDVSSFKNYEELCSAIECMFGLDGLLNNPKRSGWKLVYVDYENDVLLIGDDPWDANI
QGTNAPITEGSHAR
Download sequence
Identical sequences B9H4U4
POPTR_0005s25800.1|PACid:18206336 XP_002307706.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]