SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s07740.1|PACid:18212523 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s07740.1|PACid:18212523
Domain Number 1 Region: 124-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.19e-43
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 1024-1085
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000106
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s07740.1|PACid:18212523
Sequence length 1119
Sequence
MKSPATGAGGTATTSTATNGEGAEKKSINPELWQACAGPLVNLPAAGTHVVYFPQGHSEQ
VAASMKKDVDAQIPNYPNLPSKLLCLLHNVTLHADPETDEVYAQMTLQPVSSFDKDALLR
SDLALKSNKPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLNFSLQPPAQELVARDL
HDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQQLLLGIRRANRQP
TNLSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVIPLAKYYKAVYSNQI
SLGMRFRMMFETEESGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGERRNRVS
IWEIEPVTAPFFICPPPFFRSKRPRQPGMPDDDSSDFDSLFKRTMPWLGDEFCMKDPQAL
PGLSLVQWMNMQQNPSLANSMQPNYMQSLSGSVLQNLPGADLSRQLGLSSPQMPQPNNVQ
FNAQRLPQQAQQLDQLPKLQSSLIPLGSIMQPQQQMGDITQQSRQNLMAQTLPSSQVQAQ
LLQPQTLAQTNNILQQQPSIQSHQLLRNLPQTLHHQQQQNQQQHIMGQNQQQSLMQSQLS
DHVNQHMQISDNHIQLQLLQKLQQQQQSLLAQQSAMQQAGQLGQLQDSQRQLLDASQSFS
RSMAPSQMLEIPQTAPTSLPQPNTIPQQLTKNNNQNNVRFSHPPQQPKLQQQHTGILPLS
EMAGHMGLLPSSMANQLSAAGSSILTAAAGQGQSGITDDVPSCSTSPSTNNCPNIVQPMI
NSRAHRSTAMGEDMAQSAATLLNPSALETVSSNGNLVKDLLQKSEVKPSLNISKNQSPGF
FTPQTYLNGVAAQTDYLDTSSSTTSICLSQNDVHLQQNNNSLSYNPQPMLLRDTIHDGEL
QADLRNNIPCGTNIDSQLTMPVSSDNLFTKGMVGLGKDFSNNFSSAGMLTSCENSKDPQQ
DLSSSMVSQSFGVPEMPFNSINSAINDNSCLNRGAWAPPQQQFQRMRTYTKVYKRGAVGR
SIDIARYSGYAELKQDLARRFGIEGQFEDQQRIGWKLVYRDLDDDVLLVGDDPWEEFVNC
VRCIKILSPQEVQQMSLDGDFGNSVLPNQACSSSDNVNA
Download sequence
Identical sequences U5G614
POPTR_0006s07740.1|PACid:18212523 XP_006381166.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]