SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s10880.1|PACid:18212167 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s10880.1|PACid:18212167
Domain Number 1 Region: 285-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.27e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s10880.1|PACid:18212167
Sequence length 880
Sequence
MASSSSSIKSCMNATCGVSTSNSGGWRKGWALRSGDFAILCDNCGSAYEQSIFCEVFHSK
DSGWRECTSCSKRLHCGCIASRSLLELLDGGGVNCTSCSRTSGVGPMNGDEKPNGFGKPK
VDTVGELHSASADSQLAAETKLMQLGNCIDGIGTRNLLQLQSDETNGTVTAAKDLYESLA
QTNLSMSLGSSLGNPNLFPGGVVDERVPSKASSPLQQGPRSRHLLPKPPKSALSMDANAG
MVSQIRVARPPAEGRGRNQLLPRYWPRITDQELQQISGDPNSTIVPLFEKVLSASDAGRI
GRLVLPKACAEAYFPPISQPEGLPLRIQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQ
SMKLQAGDTVTFSRMDPEGKLVMGFRKASNSIAMQQDTQPSAIPNGVPSSESYFSGVFEN
LPIISGYSGLLQSLKGSTDTHLSALSKHLHSASGDISWNKSEKQEDRTRDGLLLPSLMVP
ERKRTRNIGSKSKRLLIDSLDAFELKLTWEEAQDLLRPAPSVKPSIVTIEDHDFEEYEEP
PVFGKRSIFIVRSIGGQEQWAQCDSCSKWRRLPVDVLLPPKWTCVDNAWDQSRCSCSAPD
ELAPRELENLLRLNKDFKKRKITSSHQPAQELESSGLDALANAAILGDVGEQSTTAVVAT
TTKHPRHRPGCSCIVCIQPPSGKGKHKPTCTCNVCMTVKRRFKTLMMRKKKRQSEREAEI
AQKTQHLVGPKDEAEIESSSKLASIPRDPSDNEARSGNELESKGQSNNLSNKLADSGKGH
LDLNCHPDREEDSQAGLSRMSMTSFLQVATLPLDTYLKQNGLASLSEQQASSASHVPPQT
GENEGKINDDCQPATAAPEQESGGEENDEPGPDQSQNDPV
Download sequence
Identical sequences B9HDI7
POPTR_0006s10880.1|PACid:18212167 XP_002309182.2.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]