SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s14070.4|PACid:18213736 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s14070.4|PACid:18213736
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-45
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 1005-1073
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000216
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s14070.4|PACid:18213736
Sequence length 1073
Sequence
MKVPSNGFLPNFAEGERKCINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TDFIPSYPNLPSKLICMLHNVTLHADVETDEVYAQMTLQPVSKYEKEALLASDMGLKQNR
QPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELVARDLHDNTWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPFSKYNKALYTQVSLGMRFRMMF
ETEESGVRRYMGTITGISDMDPVRWKNSQWRNLQVGWDESTAGERPSRVSIWEIEPVVTP
FYIYPPPFFRPKFPKQPGMPDDDSDIENAFKRAMPWLGDEFGMKDPPSSIFPGLSLVQWM
SMQQNNQFPATQSGLFPSMVPSNALHNNLSTDDPSKVLNFQAPGLSPPSVQLNKTNPQNQ
VGQLPQPPMAWTQQQQLQQLLQTPINQQLQQLLQTPINQQQPPYPHQQQQQPISQQQQHQ
HWPQQQQQPQLQPPQIRQPPPQIQQHQQQQQIFQPPTLNDSVVAPNQIPNQNLQQPVVYS
QLQQQQQLLASNTQSQSIPSANKSSYPLTSLPQDSQLHQQMEQQSNLSQRQQQQTQLQQS
PLLLIQQNLSQRAQPQQQQQQQLQQLSQPSHSEQQLHFQLLQKLQQHQQLPSPASSVLQS
QQLQQQQQQTHQQHQQLQQSPLSQNQQPLGSNSFSTAALMQTQSLMQTQSFPMNQPQGLQ
KPPMAVRARSSITDGEAPSCSTSPSTNNCQISPQNFLNRNHLAPAMLMGDSAIEPASNLV
QDLQNKSEIRVKNEFPSSRGLDQLKYKGAVTDQLEASSSGTSYCLDAGNIQQNFSVPTFG
LDSDVQSHPRNSLPFASNIDALAPDTLLSRGYDSQKDLQNLLANYGGTTRDIETELSTAA
ISSQSFAVPNIPFKPGCSNDVAINDTGVLNNGLWTNQTNQTQRMRTYTKVQKRGSVGRSI
DVTRYKGYNELRHDLARMFGIEGQLEDPQSSDWKLVYVDHENDILLVGDDPWE
Download sequence
Identical sequences U5GD78
XP_006381580.1.11743 POPTR_0006s14070.4|PACid:18213736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]