SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s15040.1|PACid:18212352 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s15040.1|PACid:18212352
Domain Number 1 Region: 263-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-16
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 55-184
Classification Level Classification E-value
Superfamily POZ domain 0.000000000018
Family BTB/POZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s15040.1|PACid:18212352
Sequence length 589
Sequence
MDNRIGFSDSNEISNGSSTCCIETPSTSKPFTNPEIVALQQLSGNLEAIFDSQDFDYFAD
AKITSSNYNREVPVHRCILSARSPFFKSVFSSPVAKDRSGVAKFELKELAKDYDVGFDSL
MTVLGYLYCGKVRPWPKDVCACVDDDCSHIACRPAVDLLTEVLYASFTFQVNELVALYQR
HLLDILDKVSTDDILVILAVANICGEACERLLTRCVEIIVKSNVDIVTLDKALPQYIVKK
IMDSRLELGLNVPENSNLLDKHVKRIHRALDSDDVELVRMLLKEAHTNLDDAHALHYAVS
YCDAKTTTEILDLGLADVNCRNSRGYTVLHVAAMRKDPKIIVSLLTKGARLSDLTLDGRK
ALQISKRLTRAMDYHKSTEEGKASPKERLCIEILEQAERRDPLLGEASLSLAMAGDDLRM
KLLYLENRVGLAKLLFPMEAKVAMDIAQVDGTSEFPLAGIRPSILSGAQRGAVDLNEAPF
RMHEEHLNRMRALSRTVELGKRFFPRCSDVLNKIMDADDLSQIAYLGNETSEERLVKRQR
HLELQDALSKAFNEDKQEFDRSVISSSSSTKSIGTARSNGKLIDMGGGH
Download sequence
Identical sequences B9HDY1
XP_002308281.1.11743 POPTR_0006s15040.1|PACid:18212352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]