SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for POPTR_0006s22460.2|PACid:18213990 from Populus trichocarpa v156

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POPTR_0006s22460.2|PACid:18213990
Domain Number 1 Region: 112-219
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-31
Family B3 DNA binding domain 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POPTR_0006s22460.2|PACid:18213990
Sequence length 332
Sequence
MSINHFSTDLQETLSWWAQQHQQQQPIMEPNPNASSSTPNEPPNISNPNSSWPPHHSWLN
PYNTAQQPSSMFLPQNPTLNFNLNEEDDEDQDHEQQQQDETQQEQEVLVLDKEPMFEKPL
TPSDVGKLNRLVIPKQHAEKYFPLSGDSVDKGLLLSFEDESGRYWKFRYSYWNSSQSYVL
TKGWSRYVKEKQLDAGDVVLFERHRTDGDRLFIGWRRRGESGSNSGVMVQGSGGGVWSRG
ILYPSSSSGPHHLSSSNIQHDLGANVTAANVPYQPYCLHAGTSCIFLCKVRDKHLPISLE
KCGWIPIGHIFSADFSGVCISVMRIQQFLKIC
Download sequence
Identical sequences U5G8L0
XP_006381963.1.11743 POPTR_0006s22460.2|PACid:18213990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]